Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heme exporter protein C (ccmC)

This Recombinant Heme exporter protein C (ccmC) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Heme exporter protein C, Cytochrome c-type biogenesis protein CcmC

UniProt

P0ABM3

Expression Region

1-245

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWKTLHQLAIPPRLYQICGWFIPWLAIASVVVLTVGWIWGFGFAPADYQQGNSYRIIYLH VPAAIWSMGIYASMAVAAFIGLVWQMKMANLAVAAMAPIGAVFTFIALVTGSAWGKPMWG TWWVWDARLTSELVLLFLYVGVIALWHAFDDRRLAGRAAGILVLIGVVNLPIIHYSVEWW NTLHQGSTRMQQSIDPAMRSPLRWSIFGFLLLSATLTLMRMRNLILLMEKRRPWVSELIL KRGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Eph receptor B1 (Tyr928) Rabbit Polyclonal Antibody (PE-Cy5.5)
orb888104 100 µL

Phospho-Eph receptor B1 (Tyr928) Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Mouse Monoclonal SAYSD1 Antibody (OTI2H3) [Alexa Fluor 594]
NBP2-72022AF594 0.1 mL

Mouse Monoclonal SAYSD1 Antibody (OTI2H3) [Alexa Fluor 594]

Sign In for Pricing
View Details
Ku-Holo (p70;83) (KU729), CF405S conjugate, 0.1mg/mL
BNC040729-100 1x 100 µL

Ku-Holo (p70;83) (KU729), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human STUB1 knockout cell line
ABC-KH14855 1 Vial

Human STUB1 knockout cell line

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Na (+)/H (+) antiporter nhaB (nhaB), partial
MBS7096454 Inquire

Recombinant Salmonella typhimurium Na (+)/H (+) antiporter nhaB (nhaB), partial

Sign In for Pricing
View Details
Macbecin I
T22960 1 mg

Macbecin I

Sign In for Pricing
View Details