Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heme exporter protein C (ccmC)

This Recombinant Heme exporter protein C (ccmC) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Heme exporter protein C, Cytochrome c-type biogenesis protein CcmC

UniProt

P0ABM3

Expression Region

1-245

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWKTLHQLAIPPRLYQICGWFIPWLAIASVVVLTVGWIWGFGFAPADYQQGNSYRIIYLH VPAAIWSMGIYASMAVAAFIGLVWQMKMANLAVAAMAPIGAVFTFIALVTGSAWGKPMWG TWWVWDARLTSELVLLFLYVGVIALWHAFDDRRLAGRAAGILVLIGVVNLPIIHYSVEWW NTLHQGSTRMQQSIDPAMRSPLRWSIFGFLLLSATLTLMRMRNLILLMEKRRPWVSELIL KRGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Smad1 (Ser465) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-10380R-BF405 100 µL

Phospho-Smad1 (Ser465) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
KATNA1 Adenovirus (Human)
25302051 1.0 mL

KATNA1 Adenovirus (Human)

Sign In for Pricing
View Details
Apolipoprotein F Recombinant Antibody, PE-Cy7 Conjugated
bsm-62052R-PE-Cy7-TR 20 µL

Apolipoprotein F Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
RPS13 polyclonal antibody
orb1720412-01 50 µL

RPS13 polyclonal antibody

Sign In for Pricing
View Details
RPS13 polyclonal antibody
orb1720412-02 100 µL

RPS13 polyclonal antibody

Sign In for Pricing
View Details
Recombinant Human High mobility group protein B1 (HMGB1) ,partial
RPC23970-01 20 µg

Recombinant Human High mobility group protein B1 (HMGB1) ,partial

Sign In for Pricing
View Details