Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heme exporter protein C (ccmC)

This Recombinant Heme exporter protein C (ccmC) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Heme exporter protein C, Cytochrome c-type biogenesis protein CcmC

UniProt

P0ABM3

Expression Region

1-245

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWKTLHQLAIPPRLYQICGWFIPWLAIASVVVLTVGWIWGFGFAPADYQQGNSYRIIYLH VPAAIWSMGIYASMAVAAFIGLVWQMKMANLAVAAMAPIGAVFTFIALVTGSAWGKPMWG TWWVWDARLTSELVLLFLYVGVIALWHAFDDRRLAGRAAGILVLIGVVNLPIIHYSVEWW NTLHQGSTRMQQSIDPAMRSPLRWSIFGFLLLSATLTLMRMRNLILLMEKRRPWVSELIL KRGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCAP Antibody
A36279-100UL 100 µL

TCAP Antibody

Sign In for Pricing
View Details
GFP/eGFP-Tag (AB1999) Rabbit mAb
M3329-01 20 µL

GFP/eGFP-Tag (AB1999) Rabbit mAb

Sign In for Pricing
View Details
GFP/eGFP-Tag (AB1999) Rabbit mAb
M3329-02 50 μL

GFP/eGFP-Tag (AB1999) Rabbit mAb

Sign In for Pricing
View Details
GFP/eGFP-Tag (AB1999) Rabbit mAb
M3329-03 100 µL

GFP/eGFP-Tag (AB1999) Rabbit mAb

Sign In for Pricing
View Details
GFP/eGFP-Tag (AB1999) Rabbit mAb
M3329-04 200 µL

GFP/eGFP-Tag (AB1999) Rabbit mAb

Sign In for Pricing
View Details
Hr 3'UTR Luciferase Stable Cell Line
TU109729 1.0 mL

Hr 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details