Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heme exporter protein C (ccmC)

This Recombinant Heme exporter protein C (ccmC) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Heme exporter protein C, Cytochrome c-type biogenesis protein CcmC

UniProt

P0ABM2

Expression Region

1-245

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWKTLHQLAIPPRLYQICGWFIPWLAIASVVVLTVGWIWGFGFAPADYQQGNSYRIIYLH VPAAIWSMGIYASMAVAAFIGLVWQMKMANLAVAAMAPIGAVFTFIALVTGSAWGKPMWG TWWVWDARLTSELVLLFLYVGVIALWHAFDDRRLAGRAAGILVLIGVVNLPIIHYSVEWW NTLHQGSTRMQQSIDPAMRSPLRWSIFGFLLLSATLTLMRMRNLILLMEKRRPWVSELIL KRGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taldo1 ORF Vector (Rat) (pORF)
ORF077409 1.0 µg DNA

Taldo1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PI16 Antibody
MBS8503301-01 0.1 mg

PI16 Antibody

Sign In for Pricing
View Details
PI16 Antibody
MBS8503301-02 0.1 mL (AF405L)

PI16 Antibody

Sign In for Pricing
View Details
PI16 Antibody
MBS8503301-03 0.1 mL (AF405S)

PI16 Antibody

Sign In for Pricing
View Details
PI16 Antibody
MBS8503301-04 0.1 mL (AF610)

PI16 Antibody

Sign In for Pricing
View Details
PI16 Antibody
MBS8503301-05 0.1 mL (AF635)

PI16 Antibody

Sign In for Pricing
View Details