Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heme exporter protein C (ccmC)

This Recombinant Heme exporter protein C (ccmC) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Heme exporter protein C, Cytochrome c-type biogenesis protein CcmC

UniProt

P0ABM2

Expression Region

1-245

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWKTLHQLAIPPRLYQICGWFIPWLAIASVVVLTVGWIWGFGFAPADYQQGNSYRIIYLH VPAAIWSMGIYASMAVAAFIGLVWQMKMANLAVAAMAPIGAVFTFIALVTGSAWGKPMWG TWWVWDARLTSELVLLFLYVGVIALWHAFDDRRLAGRAAGILVLIGVVNLPIIHYSVEWW NTLHQGSTRMQQSIDPAMRSPLRWSIFGFLLLSATLTLMRMRNLILLMEKRRPWVSELIL KRGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Matrin 3 Antibody [Alexa Fluor 594]
NB100-1559AF594 0.1 mL

Rabbit Polyclonal Matrin 3 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Lamivudine 5'-monophosphate triethyammonium salt
296228-01 1 mg

Lamivudine 5'-monophosphate triethyammonium salt

Sign In for Pricing
View Details
Lamivudine 5'-monophosphate triethyammonium salt
296228-02 2 mg

Lamivudine 5'-monophosphate triethyammonium salt

Sign In for Pricing
View Details
Lamivudine 5'-monophosphate triethyammonium salt
296228-03 5 mg

Lamivudine 5'-monophosphate triethyammonium salt

Sign In for Pricing
View Details
Rabbit anti Human FABP6  Monoclonal Antibody
MBS2544379-01 0.06 mL

Rabbit anti Human FABP6  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Human FABP6  Monoclonal Antibody
MBS2544379-02 0.12 mL

Rabbit anti Human FABP6  Monoclonal Antibody

Sign In for Pricing
View Details