Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heme exporter protein C (ccmC)

This Recombinant Heme exporter protein C (ccmC) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Heme exporter protein C, Cytochrome c-type biogenesis protein CcmC

UniProt

P0ABM4

Expression Region

1-245

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWKTLHQLAIPPRLYQICGWFIPWLAIASVVVLTVGWIWGFGFAPADYQQGNSYRIIYLH VPAAIWSMGIYASMAVAAFIGLVWQMKMANLAVAAMAPIGAVFTFIALVTGSAWGKPMWG TWWVWDARLTSELVLLFLYVGVIALWHAFDDRRLAGRAAGILVLIGVVNLPIIHYSVEWW NTLHQGSTRMQQSIDPAMRSPLRWSIFGFLLLSATLTLMRMRNLILLMEKRRPWVSELIL KRGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1d Mouse qPCR Primer Pair (NM_020558)
MP209049 200 Reactions

C1d Mouse qPCR Primer Pair (NM_020558)

Sign In for Pricing
View Details
CDCA3 Mouse Monoclonal Antibody [Clone:6F7]
E45M20395 100 µg

CDCA3 Mouse Monoclonal Antibody [Clone:6F7]

Sign In for Pricing
View Details
NUP37 Overexpression Lysate (Native) - (Dry Ice)
NBL1-13875 0.1 mg

NUP37 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
PIC 1401-148X148-B7527 Fire & Disaster Signs (No Adhesive)
803763 1 Card (1 Panel (s) x 1 Pack)

PIC 1401-148X148-B7527 Fire & Disaster Signs (No Adhesive)

Sign In for Pricing
View Details
Ctf2 Protein (N-His, Mus musculus (Mouse) )
P502935 100 µg

Ctf2 Protein (N-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details
COL4A1 Antibody
CSB-PA11464A0Rb-01 50 µg

COL4A1 Antibody

Sign In for Pricing
View Details