Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Probable ABC transporter permease protein BMEII0107 (BMEII0107)

This Recombinant Brucella melitensis biotype 1 Probable ABC transporter permease protein BMEII0107 (BMEII0107) spans the amino acid sequence from region 1-246.

Product Specifications

Product Name Alternative

Probable ABC transporter permease protein BMEII0107

UniProt

Q8YDR8

Expression Region

1-246

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNARLTGLGLNLLSFAVGIGGWYLLTATGAVVLPGPVDVLERAVTLLLNGQLVGDIFASL RRVLSGFVLGVALAIPVGFLMGWYRIARSLIEPWVQFFRMIPPLAVIPLAIVTLGIDESP KIFVIFLASFLSSVVATYQGVISVDRTLINAARVLGAKDATIFARVIVPASVPFILVGVR IGLGSAWATVVAAELIAAQSGLGYRMQQAQLYYDLPTIFVSLVTIGILGLFMDRLLQAAD RRLTQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brucella Abortus rplW Protein (aa 1-97)
VAng-Lsx5311-1mgEcoli 1 mg (E. coli)

Recombinant Brucella Abortus rplW Protein (aa 1-97)

Sign In for Pricing
View Details
Lentiviral mouse Smim3 shRNA (UAS) - Lentiviral mouse Smim3 shRNA (UAS) (100)
GTR15182790 1 Vial

Lentiviral mouse Smim3 shRNA (UAS) - Lentiviral mouse Smim3 shRNA (UAS) (100)

Sign In for Pricing
View Details
Ces3a Protein Vector (Mouse) (pPB-C-His)
PV164922 500 ng

Ces3a Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Hsa-miR-6875-3p miRNA Antagomir
orb1913896-01 10 nmol

Hsa-miR-6875-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-6875-3p miRNA Antagomir
orb1913896-02 20 nmol

Hsa-miR-6875-3p miRNA Antagomir

Sign In for Pricing
View Details
Sorbic acid, 1-p-tolylhydrazide
orb1992395-01 1 mg

Sorbic acid, 1-p-tolylhydrazide

Sign In for Pricing
View Details