Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Heme exporter protein C (ccmC)

This Recombinant Haemophilus influenzae Heme exporter protein C (ccmC) spans the amino acid sequence from region 1-246.

Product Specifications

Product Name Alternative

Heme exporter protein C, Cytochrome c-type biogenesis protein CcmC

UniProt

P45034

Expression Region

1-246

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWKWLHPYAKPETQYRICGKLSPLFAFLTLVLLGVGIVWGLAFAPADYQQGNSFRIMYVH APTAIWSMGVYGSMAIAAVVALVWQIKQAHLAMIAMAPIGALFTFLSLVTGAIWGKPMWG TWWVWDARLTAELILFFLYLGILALYSAFSDRNIGAKAAGILCITTVVILPIIHFSVEWW NTLHQGASITKLEKPSIAIPMLVPLILCIFGFLTLYIWLTLVRYRMELLKEDAKRPWVKA LAQTLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-500 1x 500 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-100 1x 100 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF568 conjugate, 0.1mg/mL
BNC682332-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2953), CF640R conjugate, 0.1mg/mL
BNC402953-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2953), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF647 conjugate, 0.1mg/mL
BNC471175-100 1x 100 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details