Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Cobalamin synthase (cobS)

This Recombinant Acinetobacter baumannii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A3M596

Expression Region

1-247

Origin

Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPFWIALQFLTVLPIELKTIPTAQQNGRAILFYPLVGLIIGGILFLVTCIFVKLPALLL AAIVLALWIWLTGGLHLDGLADTADAWVGGFGDKLRTLQIMKDPSCGPIGVLSLVIICLL KFALVYVLIEQHQSLFLICIPILGRVVPSILFLTTPYVREKGLGRSLTDHLPKTASWIIT GFVLLLPLYWGWQGLIAIIGFLISLVYLRHVFIKRIGGITGDTVGAAIEIGETVLMFTFV VSYFYLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGKB (NM_004080) Human Recombinant Protein
PH35434M5 20 µg

DGKB (NM_004080) Human Recombinant Protein

Sign In for Pricing
View Details
Rat luteinizing hormone (LH) Elisa kit
CSB-E12654r-01 48 Tests

Rat luteinizing hormone (LH) Elisa kit

Sign In for Pricing
View Details
Rat luteinizing hormone (LH) Elisa kit
CSB-E12654r-02 96 Tests

Rat luteinizing hormone (LH) Elisa kit

Sign In for Pricing
View Details
Rat luteinizing hormone (LH) Elisa kit
CSB-E12654r-03 5x 96 Tests

Rat luteinizing hormone (LH) Elisa kit

Sign In for Pricing
View Details
Rat luteinizing hormone (LH) Elisa kit
CSB-E12654r-04 10x 96 Tests

Rat luteinizing hormone (LH) Elisa kit

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Brain Derived Neurotrophic Factor (BDNF)
MBS2035012-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Brain Derived Neurotrophic Factor (BDNF)

Sign In for Pricing
View Details