Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Cobalamin synthase (cobS)

This Recombinant Acinetobacter baumannii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A3M596

Expression Region

1-247

Origin

Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPFWIALQFLTVLPIELKTIPTAQQNGRAILFYPLVGLIIGGILFLVTCIFVKLPALLL AAIVLALWIWLTGGLHLDGLADTADAWVGGFGDKLRTLQIMKDPSCGPIGVLSLVIICLL KFALVYVLIEQHQSLFLICIPILGRVVPSILFLTTPYVREKGLGRSLTDHLPKTASWIIT GFVLLLPLYWGWQGLIAIIGFLISLVYLRHVFIKRIGGITGDTVGAAIEIGETVLMFTFV VSYFYLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glmn (NM_001161738) Mouse Tagged ORF Clone Lentiviral Particle
MR223429L4V 200 µL

Glmn (NM_001161738) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SDAD1 siRNA (Mouse)
orb1836381-01 15 nmol

SDAD1 siRNA (Mouse)

Sign In for Pricing
View Details
SDAD1 siRNA (Mouse)
orb1836381-02 30 nmol

SDAD1 siRNA (Mouse)

Sign In for Pricing
View Details
hsa-miR-4731-3p miRNA Mimic
MCH02615 2x 2.5 nmol

hsa-miR-4731-3p miRNA Mimic

Sign In for Pricing
View Details
Pxn Recombinant Antibody
RAC07699-01 50 µL

Pxn Recombinant Antibody

Sign In for Pricing
View Details
Pxn Recombinant Antibody
RAC07699-02 100 µL

Pxn Recombinant Antibody

Sign In for Pricing
View Details