Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri Cobalamin synthase (cobS)

This Recombinant Citrobacter koseri Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A8AER0

Expression Region

1-247

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPTRWSQGLDFEEYSRGIVTFPLIGMLLGAIGGLVFVALQSWCG IPLAALFCVLTLALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKVLVISELALRGTPMLAALAMACAAGRGVAVLLMYRHRYAREEGLGNVFIGKVTGRQ TCVTLGLTAILAAILMPGMHGVAALVVTLAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2E2 siRNA (Human)
orb1866254-01 15 nmol

GTF2E2 siRNA (Human)

Sign In for Pricing
View Details
GTF2E2 siRNA (Human)
orb1866254-02 30 nmol

GTF2E2 siRNA (Human)

Sign In for Pricing
View Details
Lentiviral mouse Fbf1 shRNA (UAS) - Lentiviral mouse Fbf1 shRNA (UAS, GFP) plasmid
GTR15275386 1 Vial

Lentiviral mouse Fbf1 shRNA (UAS) - Lentiviral mouse Fbf1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Dog Tumor necrosis factor receptor superfamily member 5 ELISA Kit
MBS2882583-01 48 Well

Dog Tumor necrosis factor receptor superfamily member 5 ELISA Kit

Sign In for Pricing
View Details
Dog Tumor necrosis factor receptor superfamily member 5 ELISA Kit
MBS2882583-02 96 Well

Dog Tumor necrosis factor receptor superfamily member 5 ELISA Kit

Sign In for Pricing
View Details
Dog Tumor necrosis factor receptor superfamily member 5 ELISA Kit
MBS2882583-03 5x 96 Well

Dog Tumor necrosis factor receptor superfamily member 5 ELISA Kit

Sign In for Pricing
View Details