Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Cobalamin synthase (cobS)

This Recombinant Salmonella paratyphi A Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B5BG59

Expression Region

1-247

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGISGLIFILLQSWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAVACAAGHGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLATMVVTLAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IDO1 Protein Lysate
MBS8413316-01 0.02 mg

Human IDO1 Protein Lysate

Sign In for Pricing
View Details
Human IDO1 Protein Lysate
MBS8413316-02 5x 0.02 mg

Human IDO1 Protein Lysate

Sign In for Pricing
View Details
RPL37AP4 AAV siRNA Pooled Vector
41611161 1.0 µg

RPL37AP4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant African swine fever virus Trans-prenyltransferase (War-084), partial
MBS1092904-01 0.5 mg (E-Coli)

Recombinant African swine fever virus Trans-prenyltransferase (War-084), partial

Sign In for Pricing
View Details
Recombinant African swine fever virus Trans-prenyltransferase (War-084), partial
MBS1092904-02 0.05 mg (Baculovirus)

Recombinant African swine fever virus Trans-prenyltransferase (War-084), partial

Sign In for Pricing
View Details
Recombinant African swine fever virus Trans-prenyltransferase (War-084), partial
MBS1092904-03 0.5 mg (Yeast)

Recombinant African swine fever virus Trans-prenyltransferase (War-084), partial

Sign In for Pricing
View Details