Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Cobalamin synthase (cobS)

This Recombinant Salmonella paratyphi A Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B5BG59

Expression Region

1-247

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGISGLIFILLQSWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAVACAAGHGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLATMVVTLAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GR antibody
STJ93409 200 µl

Anti-GR antibody

Sign In for Pricing
View Details
BOC-D-FMK
C04195 5 mg

BOC-D-FMK

Sign In for Pricing
View Details
FoxA1/HNF3α (IHC578) Mouse Monoclonal Antibody
CST 59197S 100 µL

FoxA1/HNF3α (IHC578) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Glutathione Synthetase (GSS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A12]
TA501932BM 100 µL

Glutathione Synthetase (GSS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A12]

Sign In for Pricing
View Details
NAT8B Antibody - middle region : HRP (ARP41606_P050-HRP)
ARP41606_P050-HRP 100 µL

NAT8B Antibody - middle region : HRP (ARP41606_P050-HRP)

Sign In for Pricing
View Details
5-[ (3-Chlorophenyl) methyl]-1,3,4-thiadiazol-2-amine
PBA18149-01 50 mg

5-[ (3-Chlorophenyl) methyl]-1,3,4-thiadiazol-2-amine

Sign In for Pricing
View Details