Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Cobalamin synthase (cobS)

This Recombinant Salmonella paratyphi A Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B5BG59

Expression Region

1-247

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGISGLIFILLQSWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAVACAAGHGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLATMVVTLAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PKAc gamma (N-GST tag)
MBS4160308-01 0.01 mg

Recombinant Human PKAc gamma (N-GST tag)

Sign In for Pricing
View Details
Recombinant Human PKAc gamma (N-GST tag)
MBS4160308-02 5x 0.01 mg

Recombinant Human PKAc gamma (N-GST tag)

Sign In for Pricing
View Details
Mouse Monoclonal hnRNP C1 + C2 Antibody (4E8)
H00003183-M02-100ug 100 µg

Mouse Monoclonal hnRNP C1 + C2 Antibody (4E8)

Sign In for Pricing
View Details
Fam160a2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7471707 1.0 µg DNA

Fam160a2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
C10orf62 (FITC)
556736-01 50 µg

C10orf62 (FITC)

Sign In for Pricing
View Details
C10orf62 (FITC)
556736-02 100 µg

C10orf62 (FITC)

Sign In for Pricing
View Details