Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia fergusonii UPF0259 membrane protein yciC (yciC)

This Recombinant Escherichia fergusonii UPF0259 membrane protein yciC (yciC) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

UPF0259 membrane protein yciC

UniProt

B7LS23

Expression Region

1-247

Origin

Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVIGHVFSPSEAQLASLDKVETLSDN AGLFEIVQNMSLEQKQVLVQASAASTFSGLIGNAILAGGMLLLIQLVSAGHRVSALRAIG ASAPILPKLFILIFLTTLMVQIGIMFVVVPGILMAIVLALAPVMLVQDKMGVFASMRSSI RLTWANMRLIAPAVLSWLLAKTALLLLASRFAALTPEVGAILANTLSNLFSAVLLIYLFR LYMLIRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-100 1x 100 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-500 1x 500 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-500 1x 500 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-100 1x 100 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-100 1x 100 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details