Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides ATP synthase subunit a (atpB)

This Recombinant Rhodobacter sphaeroides ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3IZ12

Expression Region

1-247

Origin

Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQFIVKKLFCHTESTAPMNECTTNIHWYDITNVTMWMAIAVLVIAAILVLGTRRRAIVP SRSQSVAELLYGFIHNMVEEVTGHEGVKYFPYVMTLFLFVLCGNVLGLLPLSFTTTSHMA VTVPLALMVFVGVTALGFMKNGPGFLKMFWVTSAPLAIRPVLAVIEVISYFVRPVSHSIR LAGNMMAGHAVIKVIAGFASIVVVSPVVVGAVTAIYALELLVAVVQAYVFTILTCVYLRD AVGDAHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant EYA2 Antibody
RC-5706-01 50 μL

Recombinant EYA2 Antibody

Sign In for Pricing
View Details
Recombinant EYA2 Antibody
RC-5706-02 100 µL

Recombinant EYA2 Antibody

Sign In for Pricing
View Details
Recombinant EYA2 Antibody
RC-5706-03 1 mL

Recombinant EYA2 Antibody

Sign In for Pricing
View Details
alpha Adducin (ADD1) (NM_001119) Human Recombinant Protein
TP323881L 1 mg

alpha Adducin (ADD1) (NM_001119) Human Recombinant Protein

Sign In for Pricing
View Details
(R)-1-(Benzyloxy)propan-2-ol
TRC-B287760-5G 5 g

(R)-1-(Benzyloxy)propan-2-ol

Sign In for Pricing
View Details
PGM3 Rabbit Polyclonal Antibody
TA379854 100 µL

PGM3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details