Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides ATP synthase subunit a (atpB)

This Recombinant Rhodobacter sphaeroides ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3IZ12

Expression Region

1-247

Origin

Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQFIVKKLFCHTESTAPMNECTTNIHWYDITNVTMWMAIAVLVIAAILVLGTRRRAIVP SRSQSVAELLYGFIHNMVEEVTGHEGVKYFPYVMTLFLFVLCGNVLGLLPLSFTTTSHMA VTVPLALMVFVGVTALGFMKNGPGFLKMFWVTSAPLAIRPVLAVIEVISYFVRPVSHSIR LAGNMMAGHAVIKVIAGFASIVVVSPVVVGAVTAIYALELLVAVVQAYVFTILTCVYLRD AVGDAHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI10B3]
CF812311 100 µg

Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI10B3]

Sign In for Pricing
View Details
Strong acid and Alkali Storage Cabinet BCBT-208
BCBT-208 1 Unit

Strong acid and Alkali Storage Cabinet BCBT-208

Sign In for Pricing
View Details
CD14 Mouse Monoclonal Antibody [Clone ID: OTI3F5]
CF811518 100 µg

CD14 Mouse Monoclonal Antibody [Clone ID: OTI3F5]

Sign In for Pricing
View Details
REV3L Human Gene Knockout Kit (CRISPR)
KN422943 1 Kit

REV3L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phenothiazine-10-propionitrile
TRC-P318060-50MG 50 mg

Phenothiazine-10-propionitrile

Sign In for Pricing
View Details
MCM6 (NM_005915) Human Recombinant Protein
TP307097 20 µg

MCM6 (NM_005915) Human Recombinant Protein

Sign In for Pricing
View Details