Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrobacter winogradskyi ATP synthase subunit a (atpB)

This Recombinant Nitrobacter winogradskyi ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3SW35

Expression Region

1-247

Origin

Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDPIHQFNIEPIFTIGHIGGQEIAFTNSSAYMFLAVALTSLLMLGTGRRLVPGRMQSIA EISYEFVADTIRTTAGKEGMKFFPFVFSIFMLVTVSNLVGIIPYTFTISSHIIVTAALAF LVFFTVLIYGFYKNGLRFFKLFVPSGIPVVILPLVVTIEVISFLSRPVSHSVRLFANMLA GHITLKVFASFVTMLGAMGIVGVFGAVLPLALVVALTALELLVAFLQAYVFTILTCIYIN DAIHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histidine-tRNA Ligase, Cytoplasmic (HARS) Antibody
abx145226-01 100 µg

Histidine-tRNA Ligase, Cytoplasmic (HARS) Antibody

Sign In for Pricing
View Details
Histidine-tRNA Ligase, Cytoplasmic (HARS) Antibody
abx145226-02 1 mg

Histidine-tRNA Ligase, Cytoplasmic (HARS) Antibody

Sign In for Pricing
View Details
Ccl22 (NM_009137) Mouse Tagged ORF Clone
MG200244 10 µg

Ccl22 (NM_009137) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RECK Rabbit Polyclonal Antibody (HRP)
orb2583849 100 µg

RECK Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Myoferlin Double Nickase Plasmid (m)
sc-432592-NIC 20 µg

Myoferlin Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Anti-Kindlin 2/FERMT2 Antibody Picoband®, FITC Conjugate
A03653-1-FITC 100 µg/Vial

Anti-Kindlin 2/FERMT2 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details