Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrobacter winogradskyi ATP synthase subunit a (atpB)

This Recombinant Nitrobacter winogradskyi ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3SW35

Expression Region

1-247

Origin

Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDPIHQFNIEPIFTIGHIGGQEIAFTNSSAYMFLAVALTSLLMLGTGRRLVPGRMQSIA EISYEFVADTIRTTAGKEGMKFFPFVFSIFMLVTVSNLVGIIPYTFTISSHIIVTAALAF LVFFTVLIYGFYKNGLRFFKLFVPSGIPVVILPLVVTIEVISFLSRPVSHSVRLFANMLA GHITLKVFASFVTMLGAMGIVGVFGAVLPLALVVALTALELLVAFLQAYVFTILTCIYIN DAIHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSCN1 siRNA (Rat)
orb1827123-01 15 nmol

FSCN1 siRNA (Rat)

Sign In for Pricing
View Details
FSCN1 siRNA (Rat)
orb1827123-02 30 nmol

FSCN1 siRNA (Rat)

Sign In for Pricing
View Details
COL4A6 (Collagen alpha-6 (IV) Chain) (PE)
125186-PE 100 µL

COL4A6 (Collagen alpha-6 (IV) Chain) (PE)

Sign In for Pricing
View Details
EED Antibody
orb1536028 50 μL

EED Antibody

Sign In for Pricing
View Details
Bovine DCN1-like protein 5, DCUN1D5 ELISA KIT
ELI-32402b 96 Tests

Bovine DCN1-like protein 5, DCUN1D5 ELISA KIT

Sign In for Pricing
View Details
Anserini NB-Ab ELISA Kit
EAN0081 96 Tests

Anserini NB-Ab ELISA Kit

Sign In for Pricing
View Details