Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thiobacillus denitrificans Cobalamin synthase (cobS)

This Recombinant Thiobacillus denitrificans Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q3SFE7

Expression Region

1-247

Origin

Thiobacillus denitrificans (strain ATCC 25259)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRGLILALGFLTRLPLPVLRDFQCAELVRAVVWFPAAGLVVGAAVALAAALGTVLDPWLG ALAGVVMWAWITGGLHLDGLADTADALGAAHRDPARFLTVLADPHVGSFGVIVLVLQLAA KLVLLHWLLTLDLPWPALVLIPAWTRWAAAGWTLLLPPLKPGLGERFAWQGNRAGWGAGG LALAAVSAITPIAFVALIPAVLWGVWMWLKLGGQTGDILGAGIEWSESAALLLAGVSLAL ARGIIAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) YJFY Polyclonal Antibody
MBS7163998 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) YJFY Polyclonal Antibody

Sign In for Pricing
View Details
Cadherin-19 Polyclonal Antibody
RA22633-01 50 µL

Cadherin-19 Polyclonal Antibody

Sign In for Pricing
View Details
Cadherin-19 Polyclonal Antibody
RA22633-02 100 µL

Cadherin-19 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse CD230 Antibody (POM6), FITC
FMC07041 100 Tests

Anti-Mouse CD230 Antibody (POM6), FITC

Sign In for Pricing
View Details
Tpsab1 AAV siRNA Pooled Vector
47401164 1.0 µg

Tpsab1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MCM Recombinant Antibody, PE Conjugated
bsm-62911R-PE-01 20 µL

MCM Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details