Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus kodakaraensis Molybdate/tungstate transport system permease protein wtpB (wtpB)

This Recombinant Pyrococcus kodakaraensis Molybdate/tungstate transport system permease protein wtpB (wtpB) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Molybdate/tungstate transport system permease protein wtpB

UniProt

Q5JEB3

Expression Region

1-247

Origin

Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Thermococcus kodakaraensis (strain KOD1) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRDYTLYLFAALGTFLIAYIAVPIAVIFLKQASDVEMLVKTLHDPYVIEAIRNSLLTAT ATALIALLFGVPLGYVLARKDFPGKSAVQALVDVPIVIPHSVVGIMLLVTFSNSILDSYK GIVAAMLFVSAPFTINAARDGFLAVDEKLEAVARTLGASRWRAFLSISLPMAFPSIASGA IMTWARAISEVGAILIVAYYPKTAQVLILEYFNNYGLRASRPIAVIMVSLSLGIFVILRW LVGRKNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF568 conjugate, 0.1mg/mL
BNC681037-100 1x 100 µL

CD44 Standard (DF1485), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-100 1x 100 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-100 1x 100 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF594 conjugate, 0.1mg/mL
BNC942556-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details