Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Cobalamin synthase (cobS)

This Recombinant Salmonella paratyphi A Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q5PDU1

Expression Region

1-247

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGISGLIFILLQSWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAVACAAGHGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLATMVVTLAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human family with sequence similarity 82, member A2 polyclonal Antibody
MBS714677-01 0.1 mL

Rabbit anti-human family with sequence similarity 82, member A2 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human family with sequence similarity 82, member A2 polyclonal Antibody
MBS714677-02 5x 0.1 mL

Rabbit anti-human family with sequence similarity 82, member A2 polyclonal Antibody

Sign In for Pricing
View Details
Sertraline . HCl
BML-NS115-0010 10 mg

Sertraline . HCl

Sign In for Pricing
View Details
RAB27B Antibody
CSB-PA019178HA01HU-01 50 µg

RAB27B Antibody

Sign In for Pricing
View Details
RAB27B Antibody
CSB-PA019178HA01HU-02 100 µg

RAB27B Antibody

Sign In for Pricing
View Details
IL12A (Interleukin 12A (Natural Killer Cell Stimulatory Factor 1, Cytotoxic Lymphocyte Maturation Factor 1, p35), CLMF, IL-12A, NFSK, NKSF1, P35)
247506 100 µg

IL12A (Interleukin 12A (Natural Killer Cell Stimulatory Factor 1, Cytotoxic Lymphocyte Maturation Factor 1, p35), CLMF, IL-12A, NFSK, NKSF1, P35)

Sign In for Pricing
View Details