Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nephroselmis olivacea Uncharacterized tatC-like protein ymf16 (YMF16)

This Recombinant Nephroselmis olivacea Uncharacterized tatC-like protein ymf16 (YMF16) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Uncharacterized tatC-like protein ymf16

UniProt

Q9TC94

Expression Region

1-247

Origin

Nephroselmis olivacea (Green alga)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFVISQHFNEIKYRFLYIFFTFLLCFIICTIYSESIMFFYVHPLINLTSMQGKHLIFTE MSEAFHTYIFLCFFTSIYCTFPYFFYQFWAFFIPSTYQFERLQLRFLSFFFFTLLFFSCI IIYFIILPEIWSFFLHFEKKSYYFNLQLEARISSYIQFTFQIFSYFFVLFQCPLFTHFSL NLNLLTISFLVNSRKYIYFLFLILAAFLSPPDILSQFFLFSLIVFMYELCVFYSCFYDSL RERIKTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ngly1 AAV siRNA Pooled Vector
31802164 1.0 µg

Ngly1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
GAS7 Protein Vector (Mouse) (pPB-C-His)
PV181286 500 ng

GAS7 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
(Glu3)-Glucagon (1-29) (human, rat, porcine)
H-8258.1000 1.0mg

(Glu3)-Glucagon (1-29) (human, rat, porcine)

Sign In for Pricing
View Details
MTIE-1 Fc Recombinant Protein
32-3123-10 10 µg

MTIE-1 Fc Recombinant Protein

Sign In for Pricing
View Details
JNJ-40411813 200mg
A12909-200 200 mg

JNJ-40411813 200mg

Sign In for Pricing
View Details
Smpdl3a Rabbit Polyclonal Antibody (Biotin)
orb2109592 100 µL

Smpdl3a Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details