Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Cytochrome b ascorbate-dependent protein 3 (cybasc3)

This Recombinant Danio rerio Cytochrome b ascorbate-dependent protein 3 (cybasc3) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cytochrome b ascorbate-dependent protein 3, EC= 1.-.-.-

UniProt

A3KPR5

Expression Region

1-247

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRGIVGFYITYLLCLILGIACVVLVVHWNFMYRDGFAWDGSSKNFNWHPVLMVTGMLVLY GNAAVVYRIPLTWGHNKLPWKLLHAGLLLLSFIFSVIGLCAVFNFHNVHHTANLYSLHSW VGICTAALFTAQWVMGFTSFLLPCTPMAVRAFVKPTHVWMGAMILVLSIVSCISGINEKL FFVLKETTNGTKPYSALPPEAVAANSLGVIIVAFGLVVLKILSNQMWQRPEPGDDEGVYR PLAYDGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Ankyrin repeat domain containing protein 56 (ANKRD56) ELISA Kit
GTR10313089 96 Well

Sheep Ankyrin repeat domain containing protein 56 (ANKRD56) ELISA Kit

Sign In for Pricing
View Details
Rhodopsin (phospho Ser334) Antibody
A0569-01 50 μL

Rhodopsin (phospho Ser334) Antibody

Sign In for Pricing
View Details
Rhodopsin (phospho Ser334) Antibody
A0569-02 100 µL

Rhodopsin (phospho Ser334) Antibody

Sign In for Pricing
View Details
Rabbit Anti-STOM antibody
SL10443R-01 50 µL

Rabbit Anti-STOM antibody

Sign In for Pricing
View Details
Rabbit Anti-STOM antibody
SL10443R-02 100 µL

Rabbit Anti-STOM antibody

Sign In for Pricing
View Details
NBN siRNA (Human)
CRH3099-01 15 nmol

NBN siRNA (Human)

Sign In for Pricing
View Details