Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Cytochrome b ascorbate-dependent protein 3 (cybasc3)

This Recombinant Danio rerio Cytochrome b ascorbate-dependent protein 3 (cybasc3) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cytochrome b ascorbate-dependent protein 3, EC= 1.-.-.-

UniProt

A3KPR5

Expression Region

1-247

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRGIVGFYITYLLCLILGIACVVLVVHWNFMYRDGFAWDGSSKNFNWHPVLMVTGMLVLY GNAAVVYRIPLTWGHNKLPWKLLHAGLLLLSFIFSVIGLCAVFNFHNVHHTANLYSLHSW VGICTAALFTAQWVMGFTSFLLPCTPMAVRAFVKPTHVWMGAMILVLSIVSCISGINEKL FFVLKETTNGTKPYSALPPEAVAANSLGVIIVAFGLVVLKILSNQMWQRPEPGDDEGVYR PLAYDGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFE2L2-set siRNA/shRNA/RNAi Lentivector (Human)
31768091 4x 500 ng

NFE2L2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
GIT2 Antibody, FITC conjugated
A54160-50UG 50 µg

GIT2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Cyp2j13 (BC016446) Mouse Tagged Lenti ORF Clone
MR205809L4 10 µg

Cyp2j13 (BC016446) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cdc20 (AR12), CF594 conjugate, 0.1mg/mL
BNC940672-100 1x 100 µL

Cdc20 (AR12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Coilin (COIL) (NM_004645) Human 3' UTR Clone
SC210813 10 µg

Coilin (COIL) (NM_004645) Human 3' UTR Clone

Sign In for Pricing
View Details
HLA-DPA1 ORF Vector (Human) (pORF)
23428011 1.0 µg DNA

HLA-DPA1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details