Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Cytochrome b ascorbate-dependent protein 3 (cybasc3)

This Recombinant Danio rerio Cytochrome b ascorbate-dependent protein 3 (cybasc3) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cytochrome b ascorbate-dependent protein 3, EC= 1.-.-.-

UniProt

A3KPR5

Expression Region

1-247

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRGIVGFYITYLLCLILGIACVVLVVHWNFMYRDGFAWDGSSKNFNWHPVLMVTGMLVLY GNAAVVYRIPLTWGHNKLPWKLLHAGLLLLSFIFSVIGLCAVFNFHNVHHTANLYSLHSW VGICTAALFTAQWVMGFTSFLLPCTPMAVRAFVKPTHVWMGAMILVLSIVSCISGINEKL FFVLKETTNGTKPYSALPPEAVAANSLGVIIVAFGLVVLKILSNQMWQRPEPGDDEGVYR PLAYDGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF860 siRNA (Human)
MBS8219079-01 15 nmol

ZNF860 siRNA (Human)

Sign In for Pricing
View Details
ZNF860 siRNA (Human)
MBS8219079-02 30 nmol

ZNF860 siRNA (Human)

Sign In for Pricing
View Details
ZNF860 siRNA (Human)
MBS8219079-03 5x 30 nmol

ZNF860 siRNA (Human)

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-376b-5p Virus
mh6371 1.0 mL

AdmiRa-Off-hsa-miR-376b-5p Virus

Sign In for Pricing
View Details
Hexafluoroantimonic acid triple distilled min. 65% aqueous sol'n
H03690-01 25 g

Hexafluoroantimonic acid triple distilled min. 65% aqueous sol'n

Sign In for Pricing
View Details
Hexafluoroantimonic acid triple distilled min. 65% aqueous sol'n
H03690-02 100 g

Hexafluoroantimonic acid triple distilled min. 65% aqueous sol'n

Sign In for Pricing
View Details