Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A5I013

Expression Region

1-248

Origin

Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPVNKNLQCEKVNFRRGAFFLPVVASIIGGIEFLVYLGLKNFL PPNVIIVLLLLFTAMITGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRMGAFGTIAMII NLLLKYQLLYSLVLKDCSIAIILAPVIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPII FLITIIALAMNTYFLGLKITIISFIAVLIITYLFYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSC5D Human Gene Knockout Kit (CRISPR)
KN426898 1 Kit

SSC5D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ILVBL Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B12]
TA503079BM 100 µL

ILVBL Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B12]

Sign In for Pricing
View Details
PROCR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12C4]
TA805779BM 100 µL

PROCR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12C4]

Sign In for Pricing
View Details
UBE2D2 Mouse Monoclonal Antibody [Clone ID: OTI1D2]
CF806505 100 µg

UBE2D2 Mouse Monoclonal Antibody [Clone ID: OTI1D2]

Sign In for Pricing
View Details
CD32A (FCGR2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G5]
TA500652AM 100 µL

CD32A (FCGR2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G5]

Sign In for Pricing
View Details
Smarcb1 Mouse Gene Knockout Kit (CRISPR)
KN516287 1 Kit

Smarcb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details