Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A5I013

Expression Region

1-248

Origin

Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPVNKNLQCEKVNFRRGAFFLPVVASIIGGIEFLVYLGLKNFL PPNVIIVLLLLFTAMITGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRMGAFGTIAMII NLLLKYQLLYSLVLKDCSIAIILAPVIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPII FLITIIALAMNTYFLGLKITIISFIAVLIITYLFYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synephrine-13C2,15N Hydrochloride Salt
TRC-S920002-1MG 1 mg

Synephrine-13C2,15N Hydrochloride Salt

Sign In for Pricing
View Details
HBP1 (Ab-402) Antibody
8B1035-AAT 50 µg

HBP1 (Ab-402) Antibody

Sign In for Pricing
View Details
Tnik Mouse Gene Knockout Kit (CRISPR)
KN518005 1 Kit

Tnik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dabigatran Etexilate Mesylate
TRC-D100150-1G 1 g

Dabigatran Etexilate Mesylate

Sign In for Pricing
View Details
Zmynd19 Mouse Gene Knockout Kit (CRISPR)
KN520119 1 Kit

Zmynd19 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SH2D1A Rabbit Polyclonal Antibody
AP05121PU-N 100 µg

SH2D1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details