Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A5I013

Expression Region

1-248

Origin

Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPVNKNLQCEKVNFRRGAFFLPVVASIIGGIEFLVYLGLKNFL PPNVIIVLLLLFTAMITGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRMGAFGTIAMII NLLLKYQLLYSLVLKDCSIAIILAPVIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPII FLITIIALAMNTYFLGLKITIISFIAVLIITYLFYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TIMM17B activation kit by CRISPRa
GA106973 1 Kit

Human TIMM17B activation kit by CRISPRa

Sign In for Pricing
View Details
TMEM151A (NM_153266) Human Recombinant Protein
TP306185M 100 µg

TMEM151A (NM_153266) Human Recombinant Protein

Sign In for Pricing
View Details
Di-O-acetyl-L-tartaric Anhydride
TRC-D400570-2G 2 g

Di-O-acetyl-L-tartaric Anhydride

Sign In for Pricing
View Details
XLF (NHEJ1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B5]
TA804327BM 100 µL

XLF (NHEJ1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B5]

Sign In for Pricing
View Details
Ku-Holo (p70;83) (KU729), CF405S conjugate, 0.1mg/mL
BNC040729-100 1x 100 µL

Ku-Holo (p70;83) (KU729), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MEIS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H2]
TA809623AM 100 µL

MEIS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H2]

Sign In for Pricing
View Details