Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A7GBL1

Expression Region

1-248

Origin

Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPVNKNLQCEKENFKRGAFFLPVVAFIIGGMEFLIYLGLKNFL PANVIIVLLILFTAMITGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRIGSYGTIALII DLLLKYQLLYSLVLKGYSIAIVLAPIIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPII FFITTIVLVLSTYFLGLRATIIPFIGVLLITYLLYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GALNT13 activation kit by CRISPRa
GA114467 1 Kit

Human GALNT13 activation kit by CRISPRa

Sign In for Pricing
View Details
Aloxe3 Mouse Gene Knockout Kit (CRISPR)
KN501162 1 Kit

Aloxe3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SEPT7 Polyclonal Antibody
E-AB-14854-01 20 µL

SEPT7 Polyclonal Antibody

Sign In for Pricing
View Details
SEPT7 Polyclonal Antibody
E-AB-14854-02 60 µL

SEPT7 Polyclonal Antibody

Sign In for Pricing
View Details
SEPT7 Polyclonal Antibody
E-AB-14854-03 120 µL

SEPT7 Polyclonal Antibody

Sign In for Pricing
View Details
SEPT7 Polyclonal Antibody
E-AB-14854-04 200 µL

SEPT7 Polyclonal Antibody

Sign In for Pricing
View Details