Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A7GBL1

Expression Region

1-248

Origin

Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPVNKNLQCEKENFKRGAFFLPVVAFIIGGMEFLIYLGLKNFL PANVIIVLLILFTAMITGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRIGSYGTIALII DLLLKYQLLYSLVLKGYSIAIVLAPIIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPII FFITTIVLVLSTYFLGLRATIIPFIGVLLITYLLYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-17A Recombinant Rabbit Monoclonal Antibody [PS01-92] - BSA and Azide free (Detector)
HA721607 100 µL

Mouse IL-17A Recombinant Rabbit Monoclonal Antibody [PS01-92] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
NEDL2 (HECW2) Human Gene Knockout Kit (CRISPR)
KN416544 1 Kit

NEDL2 (HECW2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zswim7 Mouse Gene Knockout Kit (CRISPR)
KN520168 1 Kit

Zswim7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOK7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F7]
TA504789BM 100 µL

DOK7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F7]

Sign In for Pricing
View Details
8-Chloro-5,10-dihydro-11H-dibenzo[b,e][1,4]-diazepin-11-one
TRC-C365250-50MG 50 mg

8-Chloro-5,10-dihydro-11H-dibenzo[b,e][1,4]-diazepin-11-one

Sign In for Pricing
View Details
Cofilin 1 (CFL1) Rabbit Monoclonal Antibody
TA422439 100 µL

Cofilin 1 (CFL1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details