Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A7FS72

Expression Region

1-248

Origin

Clostridium botulinum (strain ATCC 19397 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPVNKNLQCEKVNFRRGAFFLPVVASIIGGIEFLVYLGLKNFL PPNVIIVLLLLFTAMITGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRMGAFGTIAMII NLLLKYQLLYSLVLKDCSIAIILAPVIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPII FLITIIALAMNTYFLGLKITIISFIAVLIITYLFYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf63 (ENKUR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6F9]
TA804172AM 100 µL

C10orf63 (ENKUR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6F9]

Sign In for Pricing
View Details
L-4-Acetylphenylalanine
TRC-A145345-25MG 25 mg

L-4-Acetylphenylalanine

Sign In for Pricing
View Details
HIST1H2AH (NM_080596) Human Recombinant Protein
TP315831L 1 mg

HIST1H2AH (NM_080596) Human Recombinant Protein

Sign In for Pricing
View Details
Zfp551 Mouse Gene Knockout Kit (CRISPR)
KN519877 1 Kit

Zfp551 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
96 Well Gradient Thermal Cycler BTHC-106
BTHC-106 1 Unit

96 Well Gradient Thermal Cycler BTHC-106

Sign In for Pricing
View Details
Pipette Tips
P4305-B 1000 Units/Case

Pipette Tips

Sign In for Pricing
View Details