Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A7FS72

Expression Region

1-248

Origin

Clostridium botulinum (strain ATCC 19397 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPVNKNLQCEKVNFRRGAFFLPVVASIIGGIEFLVYLGLKNFL PPNVIIVLLLLFTAMITGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRMGAFGTIAMII NLLLKYQLLYSLVLKDCSIAIILAPVIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPII FLITIIALAMNTYFLGLKITIISFIAVLIITYLFYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3’-Hydroxy Valbenazine
TRC-H996060-5MG 5 mg

3’-Hydroxy Valbenazine

Sign In for Pricing
View Details
Txn2 Mouse Gene Knockout Kit (CRISPR)
KN318507LP 1 Kit

Txn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TSGA10IP Antibody
KC-3580-01 50 μL

TSGA10IP Antibody

Sign In for Pricing
View Details
TSGA10IP Antibody
KC-3580-02 100 µL

TSGA10IP Antibody

Sign In for Pricing
View Details
TSGA10IP Antibody
KC-3580-03 1 mL

TSGA10IP Antibody

Sign In for Pricing
View Details
Cyclin Y (CCNY) (Center) Rabbit Polyclonal Antibody
AP50823PU-N 400 µL

Cyclin Y (CCNY) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details