Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium phaeobacteroides Cobalamin synthase (cobS)

This Recombinant Chlorobium phaeobacteroides Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B3EJP7

Expression Region

1-248

Origin

Chlorobium phaeobacteroides (strain BS1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRGLVTAVRTLTVLPVPGKEAERFSSALFWFPVVGLFLGLLQAGAGYLAMLSGWPELAAS MVLIAGVLLTRGMHADGFADMADGFFGGRDRESRLRIMKDPSVGSFGAIGLILLFLFKSI VLVKLLAFGLYPWIVSGVLLARLVQVALASMLPYARREGGTAAGFVEGAGIQHFVAAFLV ALFILLLLMNGEMLPSGIGLSAAIAGAVLMSLLTIKKIGGVTGDVLGASSEFTEVLVWVS GVFLALCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIC4 Rabbit Monoclonal Antibody
E10G21232 100 µL

CLIC4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Gba2 shRNA (UAS) - Lentiviral mouse Gba2 shRNA (UAS, RFP) (25)
GTR15289931 1 Vial

Lentiviral mouse Gba2 shRNA (UAS) - Lentiviral mouse Gba2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Kv4.2 Rabbit pAb, AE conjugated
orb2827588 100 µL

Kv4.2 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
LIMCH1 Knockout MES-OV Polyclonal Cells
ARG6840 1 Million

LIMCH1 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
IGLVI-70 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV765636 1.0 µg DNA

IGLVI-70 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
GRF-1 (Phospho-Tyr1105) Polyclonal Conjugated Antibody
C12009 100 µL

GRF-1 (Phospho-Tyr1105) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details