Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium phaeobacteroides Cobalamin synthase (cobS)

This Recombinant Chlorobium phaeobacteroides Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B3EJP7

Expression Region

1-248

Origin

Chlorobium phaeobacteroides (strain BS1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRGLVTAVRTLTVLPVPGKEAERFSSALFWFPVVGLFLGLLQAGAGYLAMLSGWPELAAS MVLIAGVLLTRGMHADGFADMADGFFGGRDRESRLRIMKDPSVGSFGAIGLILLFLFKSI VLVKLLAFGLYPWIVSGVLLARLVQVALASMLPYARREGGTAAGFVEGAGIQHFVAAFLV ALFILLLLMNGEMLPSGIGLSAAIAGAVLMSLLTIKKIGGVTGDVLGASSEFTEVLVWVS GVFLALCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL10 Antibody (Biotin)
orb1216859 50 µg

CXCL10 Antibody (Biotin)

Sign In for Pricing
View Details
ARH (LDLRAP1) Mouse Monoclonal Antibody [Clone 2B2]
E45M11971V-2 50 µL

ARH (LDLRAP1) Mouse Monoclonal Antibody [Clone 2B2]

Sign In for Pricing
View Details
Mouse Nucleoporin 37kDa ELISA kit
GTR10402701 96 Well

Mouse Nucleoporin 37kDa ELISA kit

Sign In for Pricing
View Details
Eravacycline HCl
T11227L1-01 1 mg

Eravacycline HCl

Sign In for Pricing
View Details
Eravacycline HCl
T11227L1-02 5 mg

Eravacycline HCl

Sign In for Pricing
View Details
Eravacycline HCl
T11227L1-03 1 mL - 10 mM (in DMSO)

Eravacycline HCl

Sign In for Pricing
View Details