Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C1FUP2

Expression Region

1-248

Origin

Clostridium botulinum (strain Kyoto / Type A2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPINKNLQCEKVNFRRGAFFLPVVAFIIGGMEFLIYLGLKNFL PANVIIVLLILFTAMVTGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRIGSYGTIALII DLLLKYQLLYSLVLKGYSIAIVLAPIIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPIV FFITTIILALSTYFLGLRATIIPFIGALLITYLLYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tdp2 Mouse Gene Knockout Kit (CRISPR)
KN517368 1 Kit

Tdp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAC1 Recombinant Rabbit monoclonal Antibody
HA750982 100 µL

RAC1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Phenanthrene-9,10-13C2
TRC-P294804-1MG 1 mg

Phenanthrene-9,10-13C2

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR561093 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
Bcl-2 (BCL2/782 + BCL2/796), 1mg/mL
BNUM1023-50 1x 50 µL

Bcl-2 (BCL2/782 + BCL2/796), 1mg/mL

Sign In for Pricing
View Details
Mouse sIgA (Secretory Immunoglobulin A) CLIA Kit
E-CL-M0603-01 24 Tests

Mouse sIgA (Secretory Immunoglobulin A) CLIA Kit

Sign In for Pricing
View Details