Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C1FUP2

Expression Region

1-248

Origin

Clostridium botulinum (strain Kyoto / Type A2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPINKNLQCEKVNFRRGAFFLPVVAFIIGGMEFLIYLGLKNFL PANVIIVLLILFTAMVTGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRIGSYGTIALII DLLLKYQLLYSLVLKGYSIAIVLAPIIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPIV FFITTIILALSTYFLGLRATIIPFIGALLITYLLYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DAND5 activation kit by CRISPRa
GA116310 1 Kit

Human DAND5 activation kit by CRISPRa

Sign In for Pricing
View Details
Purified Anti-Human IL-17 Antibody[BL168]
E-AB-F1173A-01 25 µg

Purified Anti-Human IL-17 Antibody[BL168]

Sign In for Pricing
View Details
Purified Anti-Human IL-17 Antibody[BL168]
E-AB-F1173A-02 100 µg

Purified Anti-Human IL-17 Antibody[BL168]

Sign In for Pricing
View Details
Human THEM5 activation kit by CRISPRa
GA117159 1 Kit

Human THEM5 activation kit by CRISPRa

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CC49), CF488A conjugate, 0.1mg/mL
BNC880732-100 1x 100 µL

TAG-72 / CA72.4 (CC49), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hexadecyl Trifluoroacetate-13C2
TRC-H291112-100MG 100 mg

Hexadecyl Trifluoroacetate-13C2

Sign In for Pricing
View Details