Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C1FUP2

Expression Region

1-248

Origin

Clostridium botulinum (strain Kyoto / Type A2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPINKNLQCEKVNFRRGAFFLPVVAFIIGGMEFLIYLGLKNFL PANVIIVLLILFTAMVTGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRIGSYGTIALII DLLLKYQLLYSLVLKGYSIAIVLAPIIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPIV FFITTIILALSTYFLGLRATIIPFIGALLITYLLYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFKFB4 (NM_004567) Human Over-expression Lysate
LC401448 20 µg

PFKFB4 (NM_004567) Human Over-expression Lysate

Sign In for Pricing
View Details
Casz1 Mouse Gene Knockout Kit (CRISPR)
KN502578 1 Kit

Casz1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Apolipoprotein A I (APOA1) (25-267) Mouse Monoclonal Antibody [Clone ID: AT1E12]
AM39003PU-S 50 µL

Apolipoprotein A I (APOA1) (25-267) Mouse Monoclonal Antibody [Clone ID: AT1E12]

Sign In for Pricing
View Details
Caspase-6 Microplate Assay Kit
RDSM197 100 Assays

Caspase-6 Microplate Assay Kit

Sign In for Pricing
View Details
Mouse Nudt1 activation kit by CRISPRa
GA202747 1 Kit

Mouse Nudt1 activation kit by CRISPRa

Sign In for Pricing
View Details
MIR4421 Human qPCR Primer Pair (MI0016758)
HP300946 200 Reactions

MIR4421 Human qPCR Primer Pair (MI0016758)

Sign In for Pricing
View Details