Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C3L2A5

Expression Region

1-248

Origin

Clostridium botulinum (strain 657 / Type Ba4)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPINKNLQCEKVNFRRGAFFLPVVASIIGGMEFLIYLGLKNFL PPNVIIVLLLLFTAMITGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRMGAFGTIAMII NLLLKYQLLYSLVLKDCSIAIILAPVIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPII FLITIIALAMNTYFLELKITIISFTAVLIITYLFYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSK3 (RPS6KA2) Mouse Monoclonal Antibody [Clone ID: OTI2H3]
CF809876 100 µg

RSK3 (RPS6KA2) Mouse Monoclonal Antibody [Clone ID: OTI2H3]

Sign In for Pricing
View Details
IL4R Rabbit Polyclonal Antibody
AP01360PU-N 100 µg

IL4R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KIF21A Human Gene Knockout Kit (CRISPR)
KN417610 1 Kit

KIF21A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uncoated Mouse SELP (P-Selectin) ELISA Kit
E-UNEL-M0027-01 5x 96 Tests

Uncoated Mouse SELP (P-Selectin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse SELP (P-Selectin) ELISA Kit
E-UNEL-M0027-02 15x 96 Tests

Uncoated Mouse SELP (P-Selectin) ELISA Kit

Sign In for Pricing
View Details
N-Benzyl Salbutamol Acetonide
TRC-B289020-25MG 25 mg

N-Benzyl Salbutamol Acetonide

Sign In for Pricing
View Details