Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C3L2A5

Expression Region

1-248

Origin

Clostridium botulinum (strain 657 / Type Ba4)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPINKNLQCEKVNFRRGAFFLPVVASIIGGMEFLIYLGLKNFL PPNVIIVLLLLFTAMITGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRMGAFGTIAMII NLLLKYQLLYSLVLKDCSIAIILAPVIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPII FLITIIALAMNTYFLELKITIISFTAVLIITYLFYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ultrasonic Homogenizer BLIH-303
BLIH-303 1 Unit

Ultrasonic Homogenizer BLIH-303

Sign In for Pricing
View Details
Fosmidomycin Sodium Salt
TRC-F728500-5MG 5 mg

Fosmidomycin Sodium Salt

Sign In for Pricing
View Details
CF®488A and 7-AAD Apoptosis Assay Kit
#30060 1 Kit

CF®488A and 7-AAD Apoptosis Assay Kit

Sign In for Pricing
View Details
Mucin 3 (MUC3/1154), CF405S conjugate, 0.1mg/mL
BNC041154-500 1x 500 µL

Mucin 3 (MUC3/1154), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lysyl tRNA synthetase (KARS) (NM_001130089) Human Over-expression Lysate
LC427157 20 µg

Lysyl tRNA synthetase (KARS) (NM_001130089) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Procollagen III C-Terminal Propeptide (PIIICP) ELISA Kit
RD-PIIICP-Hu-01 96 Tests

Human Procollagen III C-Terminal Propeptide (PIIICP) ELISA Kit

Sign In for Pricing
View Details