Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus horikoshii Molybdate/tungstate transport system permease protein wtpB (wtpB)

This Recombinant Pyrococcus horikoshii Molybdate/tungstate transport system permease protein wtpB (wtpB) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Molybdate/tungstate transport system permease protein wtpB

UniProt

O57893

Expression Region

1-248

Origin

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGRDYALYFFAALGSFLVVYIVLPIVTIFAKQALDFEMLVKTVHDPLVLEALRNSLLTA TATALISLFFGVPLGYILARKDFRGKNFVQAIIDVPVVIPHSVVGIMLLVTFSNAILDSY KGIIAAMLFVSAPFAINSARDGFLAVDEKLEHVARTLGASRIRTFFSISLPMALPSIASG GIMAWARSMSEVGAILIVAYYPKTAQILVMEYFNNYGLRASRPISVMLMLISLSIFVFLR WLIGRVRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-100 1x 100 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-100 1x 100 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (CTC05), CF555 conjugate, 0.1mg/mL
BNC550887-500 1x 500 µL

Cytochrome C (CTC05), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), 1mg/mL
BNUM2216-50 1x 50 µL

CD50 / ICAM3 (CG106), 1mg/mL

Sign In for Pricing
View Details