Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B1IGK6

Expression Region

1-248

Origin

Clostridium botulinum (strain Okra / Type B1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPVNKNLQCEKENFRRGAFFLPVVAFIIGGMEFLIYLALKNFL PPNVIIVLLILFTAMITGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRIGSYGTIALII DLLLKYQLLYSLVLKGYSIAIVLAPIIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPII FFITTIVLALSTYFLGLRATIIPFIGVLLITYLLYLLCLNKINGLTGDTLGACNELGEIT FLLILLMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IVNS1ABP CRISPR Activation Plasmid (h)
sc-409224-ACT 20 µg

IVNS1ABP CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Smad2(Phospho Ser255) Rabbit Polyclonal Antibody
JOT-AP04776-01 20 µL

Smad2(Phospho Ser255) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Smad2(Phospho Ser255) Rabbit Polyclonal Antibody
JOT-AP04776-02 50 μL

Smad2(Phospho Ser255) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Smad2(Phospho Ser255) Rabbit Polyclonal Antibody
JOT-AP04776-03 100 µL

Smad2(Phospho Ser255) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCP2, ID (Non-specific Lipid-transfer Protein, Propanoyl-CoA C-acyltransferase, NSL-TP, Sterol Carrier Protein 2, SCP-2, Sterol Carrier Protein X, SCP-X, SCP-chi, SCPX) (MaxLight 405) discontinued
S0519-85A-ML405 100 µL

SCP2, ID (Non-specific Lipid-transfer Protein, Propanoyl-CoA C-acyltransferase, NSL-TP, Sterol Carrier Protein 2, SCP-2, Sterol Carrier Protein X, SCP-X, SCP-chi, SCPX) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RAB1B (Ras-related protein Rab-1B) (MaxLight 650)
132168-ML650 100 µL

RAB1B (Ras-related protein Rab-1B) (MaxLight 650)

Sign In for Pricing
View Details