Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Roseobacter denitrificans ATP synthase subunit a (atpB)

This Recombinant Roseobacter denitrificans ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q16AM8

Expression Region

1-248

Origin

Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114) ) (Roseobacter denitrificans)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADKAEGGGLVFKPMEQFEITALFGGDVTWYTPTNTALWMGFSIIAVVLLLVVGSSKRAV VPSRAQSVAELAYGFIYKMVEDICGKEGLKFFPYIMTLFMFIVCANFLGLIPSSFTPTSH FAVTVVLALAVFVTVTILGFVKNGTAFLSLFWVSSAPLALRPVLAIIEIISYFVRPVSHS IRLAGNVMAGHAVIKVFAGFAALTLVSPVAILGITAMYGLEVLVSFIQAYVFTILTCVYL KDALHPHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F8A3 (NM_001007524) Human Over-expression Lysate
LC423494 20 µg

F8A3 (NM_001007524) Human Over-expression Lysate

Sign In for Pricing
View Details
Orbital Shaker BSOT-1602
BSOT-1602 1 Unit

Orbital Shaker BSOT-1602

Sign In for Pricing
View Details
Recombinant CCN2 Antibody
RN-14712-01 50 μL

Recombinant CCN2 Antibody

Sign In for Pricing
View Details
Recombinant CCN2 Antibody
RN-14712-02 100 µL

Recombinant CCN2 Antibody

Sign In for Pricing
View Details
Recombinant CCN2 Antibody
RN-14712-03 1 mL

Recombinant CCN2 Antibody

Sign In for Pricing
View Details
Elab Fluor® 647 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]
AN00338M-01 50 Tests

Elab Fluor® 647 Goat Anti-Mouse IgG (H+L) Antibody[Poly1440]

Sign In for Pricing
View Details