Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Roseobacter denitrificans ATP synthase subunit a (atpB)

This Recombinant Roseobacter denitrificans ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q16AM8

Expression Region

1-248

Origin

Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114) ) (Roseobacter denitrificans)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADKAEGGGLVFKPMEQFEITALFGGDVTWYTPTNTALWMGFSIIAVVLLLVVGSSKRAV VPSRAQSVAELAYGFIYKMVEDICGKEGLKFFPYIMTLFMFIVCANFLGLIPSSFTPTSH FAVTVVLALAVFVTVTILGFVKNGTAFLSLFWVSSAPLALRPVLAIIEIISYFVRPVSHS IRLAGNVMAGHAVIKVFAGFAALTLVSPVAILGITAMYGLEVLVSFIQAYVFTILTCVYL KDALHPHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyroxsulam Sulfonic Acid Sodium Salt
TRC-P599995-10MG 10 mg

Pyroxsulam Sulfonic Acid Sodium Salt

Sign In for Pricing
View Details
Human BTBD6 activation kit by CRISPRa
GA113980 1 Kit

Human BTBD6 activation kit by CRISPRa

Sign In for Pricing
View Details
Mini Sample Mouse CHI3L1 (Chitinase 3-like 1) ELISA Kit
E-MSEL-M0109-01 24 Tests

Mini Sample Mouse CHI3L1 (Chitinase 3-like 1) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse CHI3L1 (Chitinase 3-like 1) ELISA Kit
E-MSEL-M0109-02 48 Tests

Mini Sample Mouse CHI3L1 (Chitinase 3-like 1) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse CHI3L1 (Chitinase 3-like 1) ELISA Kit
E-MSEL-M0109-03 96 Tests

Mini Sample Mouse CHI3L1 (Chitinase 3-like 1) ELISA Kit

Sign In for Pricing
View Details
Norethandrolone
TRC-N675000-10MG 10 mg

Norethandrolone

Sign In for Pricing
View Details