Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dinoroseobacter shibae ATP synthase subunit a (atpB)

This Recombinant Dinoroseobacter shibae ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A8LKI0

Expression Region

1-248

Origin

Dinoroseobacter shibae (strain DFL 12)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATEEGTGLTFYPMDQFIVSPLFGDGPVHFYTPTNVTLWMALAVAAIALLLVAGTRGRAV VPSRAQSIAELAYGFVYKMVEDVTGKDGIKYFPYIFTLFMFILVANFLGLIPMSFTTTSH IAVTAVLALAVFITVTVIGFVKNGAGFLSLFWVASAPLALRPILAVIEIISYFVRPVSHS IRLAGNMMAGHAVLKVFAGFAQVAAVAPIAIIGVMAIYGLEVLVSAIQAYVFTILTCVYL KDALHPHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Hydroxybutanoic Acid
TRC-H831185-25G 25 g

2-Hydroxybutanoic Acid

Sign In for Pricing
View Details
BMZERO™, 500 ml
0401 500 mL

BMZERO™, 500 ml

Sign In for Pricing
View Details
Human Thromboxane Receptor (TP) ELISA Kit
RD-TBXA2R-Hu-01 96 Tests

Human Thromboxane Receptor (TP) ELISA Kit

Sign In for Pricing
View Details
Human Thromboxane Receptor (TP) ELISA Kit
RD-TBXA2R-Hu-02 48 Tests

Human Thromboxane Receptor (TP) ELISA Kit

Sign In for Pricing
View Details
Human TMEM135 activation kit by CRISPRa
GA112234 1 Kit

Human TMEM135 activation kit by CRISPRa

Sign In for Pricing
View Details
V5 tag Recombinant Rabbit monoclonal Antibody [SY30-01]
ET1605-41-50UL 50 µL

V5 tag Recombinant Rabbit monoclonal Antibody [SY30-01]

Sign In for Pricing
View Details