Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dinoroseobacter shibae ATP synthase subunit a (atpB)

This Recombinant Dinoroseobacter shibae ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A8LKI0

Expression Region

1-248

Origin

Dinoroseobacter shibae (strain DFL 12)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATEEGTGLTFYPMDQFIVSPLFGDGPVHFYTPTNVTLWMALAVAAIALLLVAGTRGRAV VPSRAQSIAELAYGFVYKMVEDVTGKDGIKYFPYIFTLFMFILVANFLGLIPMSFTTTSH IAVTAVLALAVFITVTVIGFVKNGAGFLSLFWVASAPLALRPILAVIEIISYFVRPVSHS IRLAGNMMAGHAVLKVFAGFAQVAAVAPIAIIGVMAIYGLEVLVSAIQAYVFTILTCVYL KDALHPHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclopentakis(1,4-butylene Terephthalate)
TRC-C989545-1MG 1 mg

Cyclopentakis(1,4-butylene Terephthalate)

Sign In for Pricing
View Details
N-Nitroso 1-(1,4-Benzodioxan-2-ylcarbonyl)piperazine
TRC-N437875-100MG 100 µg

N-Nitroso 1-(1,4-Benzodioxan-2-ylcarbonyl)piperazine

Sign In for Pricing
View Details
DEPDC1B (C-term) Rabbit Polyclonal Antibody
AP51243PU-N 400 µL

DEPDC1B (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Beta 2 Microglobulin Recombinant Rabbit monoclonal Antibody
HA723430 100 µL

Beta 2 Microglobulin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Presenilin 2 (PSEN2) Human Gene Knockout Kit (CRISPR)
KN202921BN 1 Kit

Presenilin 2 (PSEN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2422), CF568 conjugate, 0.1mg/mL
BNC682422-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2422), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details