Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodopseudomonas palustris ATP synthase subunit a (atpB)

This Recombinant Rhodopseudomonas palustris ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B3QF37

Expression Region

1-248

Origin

Rhodopseudomonas palustris (strain TIE-1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADPIHQFQITKLFTLGHVGGQEIAFTNSSAYMFGTVALIAILMLVPGRQLVPGRLQSI AELSYEFVANMIRSTAGKEGLKFFPLVFSLFMFIAVSNLIGIVPYTFTVSSHLIVTVALA LLVFFTVLIYGFSKNGLKFFKLFVPSGVPIYILPLVVFIEVISFFLKPVSHSVRLFANML AGHIALKVFASFVAMLGALGVVGWFGAVLPLGLTIALTALELLVAFLQAYVFAILTCIYL NDAIHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-500 1x 500 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
BNC740965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-100 1x 100 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3/863 + 1G12), CF488A conjugate, 0.1mg/mL
BNC880864-500 1x 500 µL

Glypican-3 (GPC3/863 + 1G12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details