Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Desulfotomaculum reducens Cobalamin synthase (cobS)

This Recombinant Desulfotomaculum reducens Cobalamin synthase (cobS) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A4J804

Expression Region

1-249

Origin

Desulfotomaculum reducens (strain MI-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSSLRLAISFLTIFPFYNKMADNKELAQSVSYYPLVGFLLGSIAAGVCYAMHSIGLNLA ADVLGLVTIITLTGGLHQDGLMDTADGIFSGRELHRKLEIMKDSRVGAMGVIALATVLLL KIAFLFELDLAQKLTAFIMAPMAGRWAMVLAITRYPYARATGGLGACLKQAGKTQLALAT LILVAGCLWLFGLPGLALLGIVFFITWLTVEFIVKRLGGMTGDTYGALGEMIETWVIFLI LLGQQIRML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB517730 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF543 conjugate, 0.1mg/mL
BNC432615-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-100 1x 100 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS808778 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Neurofilament (NF-L) (NFL/736), Biotin conjugate, 0.1mg/mL
BNCB0736-500 1x 500 µL

Neurofilament (NF-L) (NFL/736), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATP6V1F Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F10]
TA502388BM 100 µL

ATP6V1F Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F10]

Sign In for Pricing
View Details