Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Desulfotomaculum reducens Cobalamin synthase (cobS)

This Recombinant Desulfotomaculum reducens Cobalamin synthase (cobS) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A4J804

Expression Region

1-249

Origin

Desulfotomaculum reducens (strain MI-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSSLRLAISFLTIFPFYNKMADNKELAQSVSYYPLVGFLLGSIAAGVCYAMHSIGLNLA ADVLGLVTIITLTGGLHQDGLMDTADGIFSGRELHRKLEIMKDSRVGAMGVIALATVLLL KIAFLFELDLAQKLTAFIMAPMAGRWAMVLAITRYPYARATGGLGACLKQAGKTQLALAT LILVAGCLWLFGLPGLALLGIVFFITWLTVEFIVKRLGGMTGDTYGALGEMIETWVIFLI LLGQQIRML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ART3 (N-term) Rabbit Polyclonal Antibody
AP12146PU-N 400 µL

ART3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Tumor-associated Calcium Signal Transducer 2/TROP-2 (C-Avi-6His) Biotinylated
PKSH034007-01 20 µg

Recombinant Human Tumor-associated Calcium Signal Transducer 2/TROP-2 (C-Avi-6His) Biotinylated

Sign In for Pricing
View Details
Recombinant Human Tumor-associated Calcium Signal Transducer 2/TROP-2 (C-Avi-6His) Biotinylated
PKSH034007-02 100 µg

Recombinant Human Tumor-associated Calcium Signal Transducer 2/TROP-2 (C-Avi-6His) Biotinylated

Sign In for Pricing
View Details
4-Acetamidobenzene-d4-sulfonyl Chloride
TRC-A170951-250MG 250 mg

4-Acetamidobenzene-d4-sulfonyl Chloride

Sign In for Pricing
View Details
Recombinant Human Cathepsin L/CTSL Protein (His Tag)
PKSH031573 50 µg

Recombinant Human Cathepsin L/CTSL Protein (His Tag)

Sign In for Pricing
View Details
BTLA (BTLA/1528), CF405S conjugate, 0.1mg/mL
BNC041528-100 1x 100 µL

BTLA (BTLA/1528), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details