Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ochrobactrum anthropi ATP synthase subunit a 1 (atpB1)

This Recombinant Ochrobactrum anthropi ATP synthase subunit a 1 (atpB1) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a 1, ATP synthase F0 sector subunit a 1, F-ATPase subunit 6 1

UniProt

A6WW77

Expression Region

1-249

Origin

Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVVASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFLGLFPYFYTVTSQIIVTFAL AVLVIGTVIVYGFFKHGLGFLKLFVPSGVPGIIVPLVVAIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLAALGPIGIGGAVLPLIMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin A2 (E67), CF594 conjugate, 0.1mg/mL
BNC940673-500 1x 500 µL

Cyclin A2 (E67), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD19 Antibody[HI19a]
E-AB-F1304Q-01 20 Tests

Elab Fluor® Violet 450 Anti-Human CD19 Antibody[HI19a]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD19 Antibody[HI19a]
E-AB-F1304Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Human CD19 Antibody[HI19a]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD19 Antibody[HI19a]
E-AB-F1304Q-03 2x 100 Tests

Elab Fluor® Violet 450 Anti-Human CD19 Antibody[HI19a]

Sign In for Pricing
View Details
Snapin Mouse Gene Knockout Kit (CRISPR)
KN516380 1 Kit

Snapin Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), 0.2mg/mL
BNUB0979-100 1x 100 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), 0.2mg/mL

Sign In for Pricing
View Details